PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G098600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family LBD
Protein Properties Length: 286aa    MW: 32232.2 Da    PI: 5.9764
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G098600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260114.66.4e-3610108199
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        aCaaCk++rrkCa+dC+lapyfp +qpk f+n+h+l+G+sn+lk+lk l++ ++++am s++y++++r + Pv+G++gvi  l++  +q++ 
  Aqcoe3G098600.1.p  10 ACAACKYQRRKCAPDCALAPYFPPDQPKMFQNAHRLYGVSNILKILKMLDPLQKKEAMLSIIYQSNIREKYPVHGCLGVIAYLEHCTHQAEL 101
                        7***********************************************************************************99999999 PP

             DUF260  93 elallke 99 
                        ela + +
  Aqcoe3G098600.1.p 102 ELADVMT 108
                        9887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.4999110IPR004883Lateral organ boundaries, LOB
PfamPF031959.7E-3510105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MTVKGGTSQA CAACKYQRRK CAPDCALAPY FPPDQPKMFQ NAHRLYGVSN ILKILKMLDP  60
LQKKEAMLSI IYQSNIREKY PVHGCLGVIA YLEHCTHQAE LELADVMTQL NICRQHHQNQ  120
ISSPSPEYSP SSHLPLATES KNVLPLFQQN PQSFNAVKSL PPNYHANGDN AYDANYTNYI  180
DSKDNNLWLQ NQYNNNNMLS IQPHLFASQA FPLQQQPAAE VLQDYDEISP VFFDVVDDRQ  240
SYIDSKEAYE SSSESSMRDT KHPIDDVAEN ELKIAAARFS LTSIN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010272196.12e-97PREDICTED: LOB domain-containing protein 27-like isoform X2
TrEMBLB9R9274e-97B9R927_RICCO; LOB domain-containing protein, putative
STRINGVIT_17s0000g05490.t011e-84(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-46LOB domain-containing protein 27